top of page

CircRNA

Gene

chr17|81914721|81915439|-|1|ciRNA|SIRT7|ENST00000574992.5|1

SIRT7

Open Reading Frame (ORF)

LKCHDPREHGSGAEWPLPNPEPLPNLAGTVQPLALPATPGASGLEEGQPLPTTGPLDSWWLDLLCVLLSKALWGDGAAPGFGSHRRGSEQPRCGRVLTSPPPLAAIPPLA

Peptide

ALWGDGAAPGFGSHR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page