top of page

CircRNA

Gene

chr17|81600340|81606814|-|3|circRNA|NPLOC4|NM_017921|9,8,7

NPLOC4

Open Reading Frame (ORF)

LLPWRTSAARLSQGARGTSRGRMASVLSASRAPSR

Peptide

GRMASVLSASR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page