top of page

CircRNA

Gene

chr17|78064721|78075278|+|5|circRNA|TNRC6C|ENST00000588061.5|6,7,8,9,10

TNRC6C

Open Reading Frame (ORF)

MEWPPSPSAAARQSPKSLPWTAPPFLTSFIRLGRNA

Peptide

MEWPPSPSAAAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page