top of page

CircRNA

Gene

chr17|75393550|75393765|-|1|circRNA|GRB2|ENST00000392562.5|2

GRB2

Open Reading Frame (ORF)

MEAIAKYDFKATADDELSFKRGDILKGGIVCPRVPERVPEERRG

Peptide

GGIVCPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page