top of page

CircRNA

Gene

chr17|67552345|67553577|+|1|ciRNA|PITPNC1|ENST00000299954.13|3

PITPNC1

Open Reading Frame (ORF)

LKSHLNVINNKLFLLVTKAAFPLKRFPLWLMKYSTGIISLSFAFIMPTLWFLISHKPIG

Peptide

AAFPLKR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page