top of page

CircRNA

Gene

chr17|58696692|58709990|+|3|circRNA|RAD51C|ENST00000583539.5|3,4,5

RAD51C

Open Reading Frame (ORF)

LSLRTRLLNGLAQQMISLANNHRLAYAVGSRCADTRMFWRSGR

Peptide

LAYAVGSRCADTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page