top of page

CircRNA

Gene

chr17|5405056|5416682|-|5|circRNA|NUP88|NM_002532|6,5,4,3,2

NUP88

Open Reading Frame (ORF)

LEILESCWVHCPCILRLKITMVMMRVLYSAYPVSPIS

Peptide

ITMVMMR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page