top of page

CircRNA

Gene

chr17|49298105|49312042|-|3|circRNA|ZNF652|ENST00000508237.5|7,6,5

ZNF652

Open Reading Frame (ORF)

LHFLMTFISFKYSDLWNFIISYQLMSTHKRHAIYMRNLWKIIQTQYVTQGALLAAFWREAL

Peptide

IIQTQYVTQGALLAAFWR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page