top of page

CircRNA

Gene

chr17|47915311|47925541|+|5|circRNA|SP2|ENST00000376741.4|2,3,4,5,6

SP2

Open Reading Frame (ORF)

LESRARRSTCATSPTVARRSVRRPCCVPMCACTLASGPLSATGSSVGRGSHGVTSSNGMLAPTQIHRPAWLPLLL

Peptide

RSTCATSPTVAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page