top of page

CircRNA

Gene

chr17|40188865|40189375|+|2|circRNA|RAPGEFL1|ENST00000456989.6|5,6

RAPGEFL1

Open Reading Frame (ORF)

MPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAGREDSLILVAVSSSGGFQRRTSHPASR

Peptide

TSHPASR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page