top of page

CircRNA

Gene

chr17|35624587|35625770|+|1|ciRNA|AP2B1|ENST00000616784.4|6

AP2B1

Open Reading Frame (ORF)

MRESMLKSAEYILLSSRYGNHVSLNLKILEGTPRLFCSACYHVMLQIFFGY

Peptide

ILEGTPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page