top of page

CircRNA

Gene

chr17|34939182|34942906|-|5|circRNA|CCT6B|NM_001193530|9,8,7,6,5

CCT6B

Open Reading Frame (ORF)

MDFVLSKMPLKMVDPRISFGSWCPSSRYEEASRRCIYPYLQRFTGI

Peptide

MDFVLSK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page