top of page

CircRNA

Gene

chr17|32933173|32936447|+|3|circRNA|TMEM98|ENST00000394642.7|3,4,5

TMEM98

Open Reading Frame (ORF)

LSHSDREACCHDNGLWGQDEDFSQCQRHHCGGQADQPQAHCGPHWCHGDPV

Peptide

LSHSDREACCHDNGLWGQDEDFSQCQR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page