top of page

CircRNA

Gene

chr17|31973145|31988497|+|5|circRNA|SUZ12|ENST00000322652.9|6,7,8,9,10

SUZ12

Open Reading Frame (ORF)

MINLRLLLPNLLPLEIQRVSIRKTSLVQLNLLKLLISHHQTQKMNKILLPWKSCL

Peptide

LLISHHQTQKMNK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page