top of page

CircRNA

Gene

chr17|29650653|29703062|-|10|circRNA|SSH2|ENST00000269033.7|12,11,10,9,8,7,6,5,4,3

SSH2

Open Reading Frame (ORF)

LSIITFGYMMKRQRISWRTGMTLTNSSLKQTSARAF

Peptide

QTSARAF

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page