top of page

CircRNA

Gene

chr17|21017941|21019185|-|2|circRNA|USP22|ENST00000261497.8|5,4

USP22

Open Reading Frame (ORF)

LTGTAVRCRAPAPVWSVRCPHCFRRRWREVFNLGTNQTGA

Peptide

LTGTAVR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page