top of page

CircRNA

Gene

chr17|18872582|18882683|+|3|circRNA|PRPSAP2|ENST00000432893.6|4,5,6

PRPSAP2

Open Reading Frame (ORF)

MDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEKQEYKFKSL

Peptide

ASPFLLQYIQEEK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page