top of page

CircRNA

Gene

chr17|16143605|16146548|-|2|circRNA|NCOR1|ENST00000268712.7|11,10

NCOR1

CircRNA UID

circNCOR1(11,10)

Open Reading Frame (ORF)

LGRGELVFQPPLLGVSMRFLKLLMGSLSRRNKKSASVMISSWRHGRKKWTE

Peptide

LGRGELVFQPPLLGVSMR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page