top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|16137310|16165161|-|10|circRNA|NCOR1|ENST00000268712.7|14,13,12,11,10,9,8,7,6,5

NCOR1

Open Reading Frame (ORF)

MRIIKPSSEGIMGNAEAETRIQHSEANMKLHPLQFRGNHVEMIKMLHLQNSQRKS

Peptide

GNHVEMIK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page