top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|15605222|15615809|-|6|circRNA|CDRT1|NM_001282540|7,6,5,4,3,2

CDRT1

Open Reading Frame (ORF)

LIAVSSNRKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRAQSRHHRCVFFP

Peptide

ALFLCEEENFLLSGSYDLSIRAQSR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page