top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr17|14461098|14463895|+|2|circRNA|Unknown|T142103|2,3

Unknown

Open Reading Frame (ORF)

LLSIHANVVIWKLFCVKEKIGSIGKAGWLERLMGS

Peptide

IGSIGKAGWLER

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page