top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|89977638|89992828|+|8|circRNA|AFG3L1P|NR_003228|2,3,4,5,6,7,8,9

AFG3L1P

Open Reading Frame (ORF)

LAGTNRPDVLDPALMRPGRFHRQIYTVVMASENVRCCIAEEARKAHLASCSSASRGSTFRS

Peptide

LAGTNRPDVLDPALMRPGR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page