top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|88627621|88628854|+|3|circRNA|ZC3H18|NM_001294340|15,16,17

ZC3H18

Open Reading Frame (ORF)

LIKEAGSAMNHQTRTGRALLQPSGPTHPQTEVPEREQRLLSVQCYVEQQLCTQRGLGGHVRRPG

Peptide

GLGGHVR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page