top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|87726764|87762040|-|6|circRNA|KLHDC4|ENST00000567298.5|7,6,5,4,3,2

KLHDC4

Open Reading Frame (ORF)

MPLIWTPSHGASCPRQGRGPHPDQAARCPSLPRAASSSMGATRNRKTWKRS

Peptide

GPHPDQAAR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page