top of page

CircRNA

Gene

chr16|86546558|86552292|-|3|circRNA|MTHFSD|NM_001159378|5,4,3

MTHFSD

Open Reading Frame (ORF)

LDSRVLVDLVVVGSVAVSEKGRFSCCRATPTLAGVQNGQDH

Peptide

VLVDLVVVGSVAVSEKGR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page