top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|791370|792195|+|1|ciRNA|CHTF18|ENST00000569270.5|4

CHTF18

Open Reading Frame (ORF)

LFLFDGWSGVEGAPSLWDTCGSPWLLGRERPVGAVHTTPSSTWAAGGTALWAPGAGEDHPGTRDCASRGVLCGGDERQVSDVRSVSGSPSVLTCLSSGGGPETGCGCSRLEGGGGLGVWAGKTCPSSGFTGSAAAASCDGLHANAAAPALGGCPARDAHCREPRWLCRREQA

Peptide

DAHCREPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page