top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|74453170|74471286|-|12|circRNA|GLG1|ENST00000205061.9|26,25,24,23,22,21,20,19,18,17,16,15

GLG1

Open Reading Frame (ORF)

MQVMTSPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDRMWQITR

Peptide

DRMWQITR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page