top of page

CircRNA

Gene

chr16|734736|737329|-|3|circRNA|NARFL|ENST00000251588.6|5,4,3

NARFL

CircRNA UID

circNARFL(5,4,3)

Open Reading Frame (ORF)

LESQREFVRRFRGQADCRQALPLLASACPGRRDPEAGEGQGLAKRLPGVQRLHHLRRDRAYHPAEPRGAEEGSRC

Peptide

RDPEAGEGQGLAK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page