top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|71655239|71656681|-|2|circRNA|PHLPP2|ENST00000568004.5|12,11

PHLPP2

Open Reading Frame (ORF)

LLWIALQRGWELCMACLMETEMRSSRACCSVRWQMCF

Peptide

GWELCMACLMETEMRSSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page