top of page

CircRNA

Gene

chr16|69366806|69368482|-|2|circRNA|TERF2|ENST00000254942.7|7,6

TERF2

Open Reading Frame (ORF)

LVHRILRQPLQNWTRRIWFFLLKLSQHHQPSKTRDPEKMKTKVQPRLTVRVARNCSPRTSA

Peptide

LTVRVAR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page