top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|68687511|68691926|+|2|circRNA|CDH3|NM_001793|12,13

CDH3

Open Reading Frame (ORF)

LCATAMAMSKPALDPGREVSSSLCWGLSWLCCEALPPLAREPFC

Peptide

LCATAMAMSKPALDPGR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page