top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|66938036|66939358|+|2|circRNA|CES2|ENST00000417689.5|2,3

CES2

Open Reading Frame (ORF)

MTFPSDSMSEDCLYLSIYTPAHSHEGSNLPARTQPVPSGPHTRGRCWGVLSM

Peptide

TQPVPSGPHTRGR

ORF Found in Long-Read

true

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

TRUE

Peptide Exists in PepTransDB

false

bottom of page