top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|56748233|56758655|+|2|circRNA|NUP93|ENST00000308159.9|2,3

NUP93

Open Reading Frame (ORF)

LESLSAATTFEPLEPVKDTDIQDLHLQWILRGLVSSFSKLNSLLLRLRASQSFPMWNGTYRRSSRRESACVPVP

Peptide

ESACVPVP

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page