top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|50749548|50754424|+|3|circRNA|CYLD|ENST00000564326.5|2,3,4

CYLD

Open Reading Frame (ORF)

LATGMEDLMECSFVVLRVLKVQFYCTSMISSQAF

Peptide

VLKVQFYCTSMISSQAF

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page