top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|4700969|4705253|-|4|circRNA|ANKS3|ENST00000614075.4|9,8,7,6

ANKS3

Open Reading Frame (ORF)

MKTKNPDSQWPPRAATDREGFLAESSPQTQRAPYSGPQKSTKI

Peptide

EGFLAESSPQTQRAPYSGPQK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page