top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|30736199|30736624|+|2|circRNA|SRCAP|NM_006662|32,33

SRCAP

Open Reading Frame (ORF)

MKRISVQPPRPRLNRWLSLQNLMRTMGFLLVRERKLAGLGLRMRRCPGLSRKLLPS

Peptide

LAGLGLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116,PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page