top of page

CircRNA

Gene

chr16|30728965|30734008|+|5|circRNA|SRCAP|NM_006662|26,27,28,29,30

SRCAP

CircRNA UID

circSRCAP(26,27,28,29,30)

Open Reading Frame (ORF)

LREATSPQPISNRTPWRKSGSGSGLNAWNGFSNLVRLMGPWHLCMGLKSWISVPCPNLLPAPSALVLLAPATPPFGLIPRLPTGLYCFPSSD

Peptide

LREATSPQPISNR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page