top of page

CircRNA

Gene

chr16|30728965|30729572|+|2|circRNA|SRCAP|NM_006662|26,27

SRCAP

Open Reading Frame (ORF)

LRTPWRKSGSGSGLNAWNGFSNLVRLMGPWHLCMGLKSWISVPCPNLLPAPSALVLLAPATPPFGLIPRLPTGLYCFPSSD

Peptide

KSGSGSGLNAWNGFSNLVR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page