top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|28955977|28959100|+|4|circRNA|NFATC2IP|ENST00000320805.8|4,5,6,7

NFATC2IP

Open Reading Frame (ORF)

LCGTNKFSRGHRDVPTAPAPGAGKGETPDTGSLTVSRIWTTLLCPHLHQGPKAERILGHSRS

Peptide

GHRDVPTAPAPGAGK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page