top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|28724321|28725012|+|3|circRNA|EIF3C|ENST00000566501.5|11,12,13

EIF3C

Open Reading Frame (ORF)

LRVRGCILTLVERMDEEFTKIMQNTDPHSQVLPRLSCCNCWFRLQRKTTWERASLSRSSSISSPLSMTTTPTWQPT

Peptide

IMQNTDPHSQVLPR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page