top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|27749583|27750306|+|1|circRNA|KIAA0556|NM_015202|16

KIAA0556

Open Reading Frame (ORF)

LKEKSPRPLEPWREKTPGLPGRRHGQGGAVSRSTHFTSHGAPSVPSTAPTGDASPTRSSRGTSWMSSCSKRAAGTATCPPPRRGSSQGCREGRMATLERQTLGVTLKSPSCLMDSAWSLTSSLPGGTDTMSASTE

Peptide

RHGQGGAVSR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page