top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|24930783|24942143|-|4|circRNA|ARHGAP17|NM_001006634|19,18,17,16

ARHGAP17

Open Reading Frame (ORF)

MYQKHLYLSPPRVLITHSTLETTLTRGPWRGSGLLAWR

Peptide

GPWRGSGLLAWR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page