top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|22225653|22225975|+|1|circRNA|EEF2K|NM_013302|2

EEF2K

Open Reading Frame (ORF)

MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYYSNLTKSERYSSSGSPANSFHFKDLRLCICPVTLAVPDTAWVKRAPQEHGRRRSHLPPGRR

Peptide

SHLPPGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page