top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|22075486|22085750|+|4|circRNA|C16orf52|ENST00000569656.5|2,3,4,5

C16orf52

Open Reading Frame (ORF)

LGSFYAKSTLLGHSYPATKIKEHSLWASCDSVKQSMDETGRASLPGFPRSGSPHCFLSSWESFH

Peptide

LGSFYAKSTLLGHSYPATK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page