top of page

CircRNA

Gene

chr16|1962930|1963148|-|1|ciRNA|RPS2|ENST00000343262.8|4

RPS2

Open Reading Frame (ORF)

LGVGPPAAYPAVLEGAALGLPGLSRLCIVALGFTRVTFVTGRERKDLLRTSDGPYCGLSFLEGCNRPWAVGSDWV

Peptide

VTFVTGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page