top of page

CircRNA

Gene

chr16|18838550|18870711|-|26|circRNA|SMG1|NM_015092|43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18

SMG1

Open Reading Frame (ORF)

MSMVGYIIGLGDRHLDNVLIDMTTGEVVHIDYNVCFEKDVSMFAVFN

Peptide

HLDNVLIDMTTGEVVHIDYNVCFEKDVSMFAVFN

ORF Found in Long-Read

false

Peptide Length

34

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page