top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|14857504|14868635|+|6|circRNA|NOMO1|ENST00000287667.11|11,12,13,14,15,16

NOMO1

Open Reading Frame (ORF)

MEMGVRMWGFITSPKESTDSACPSLLKQKLMAHSALRT

Peptide

LMAHSALR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page