top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|14212353|14218998|+|4|circRNA|MKL2|NM_014048|5,6,7,8

MKL2

Open Reading Frame (ORF)

LGRRTIPTLRAISHLMKTAVTLCLRTSLRVRSHRGQPRPQVSQKLVNRHLL

Peptide

SHRGQPRPQVSQK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page