top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr16|11767416|11779363|-|10|circRNA|ZC3H7A|ENST00000396516.6|12,11,10,9,8,7,6,5,4,3

ZC3H7A

Open Reading Frame (ORF)

MDFTYHANIDHKCKKDILIGRIKNVEDKSWKKIRPRPTKTNYEGPYYICKGIFACSREKSF

Peptide

TNYEGPYYICKGIFACSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page