top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr15|93000511|93020258|+|7|circRNA|CHD2|ENST00000394196.8|32,33,34,35,36,37,38

CHD2

Open Reading Frame (ORF)

MVVATTIHHGEATGTISMSSTGTRTTIMGTGDIWMPTVPEAIDPTTCPERGLMTSTAVTETTGDTEIIMTGQIKEAEASGKEGKQSAQAERGAWN

Peptide

GLMTSTAVTETTGDTEIIMTGQIK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page